PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01000.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 400aa    MW: 45047 Da    PI: 4.6936
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01000.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.1e-182471148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+ Ed+ll+ +v ++G g+W+++ ++ g+ R++k+c++rw ++l
  Rsa1.0_01000.1_g00006.1 24 KGPWTPAEDQLLIAYVDKHGEGNWNAVQKHSGLSRCGKSCRLRWVNHL 71
                             79*******************************************996 PP

2Myb_DNA-binding43.11e-1377120146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              +g++T  E++l +++++ +G++ W++ a+ ++ gRt++++k++w++
  Rsa1.0_01000.1_g00006.1  77 KGAFTDKEEQLVIELHASMGNK-WARMAAQLP-GRTDNEIKNFWNT 120
                              799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.9221975IPR017930Myb domain
SMARTSM007175.2E-162373IPR001005SANT/Myb domain
SuperFamilySSF466893.67E-2923118IPR009057Homeodomain-like
PfamPF002494.7E-172471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-242578IPR009057Homeodomain-like
CDDcd001677.74E-132671No hitNo description
SMARTSM007174.4E-1476124IPR001005SANT/Myb domain
PROSITE profilePS5129419.1976126IPR017930Myb domain
PfamPF002496.8E-1377120IPR001005SANT/Myb domain
CDDcd001677.21E-1079122No hitNo description
Gene3DG3DSA:1.10.10.604.0E-2479124IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MGKVLREDDF GSDQDVAIEK TFQKGPWTPA EDQLLIAYVD KHGEGNWNAV QKHSGLSRCG  60
KSCRLRWVNH LRPSLKKGAF TDKEEQLVIE LHASMGNKWA RMAAQLPGRT DNEIKNFWNT  120
RLKKLQRLGL PIYPDEVLEQ AMNASSQNGQ NSNSLDGTTH HHSQESLELD CLEIPEFDFK  180
YLQLDNCSSY YQSLLRNVPM GNIMGSPYMS PNRKRLREPE TDFLDTDGYA TNDEQNAQLW  240
DYPQFHVVPE THLLGSDATY SFPPSGPEAE KLELPSFQCF DPPGDWERLL HSNPMPFVEM  300
SDSTLVQSPP LADCPSPGLL ESVVYGSSGE KQATNTDPDS PLLQSSLFGH IELTPAATAN  360
NTETDLVRFG PTTSSERRTS LESGDWIRQL LGEDRDYHTK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29241247106B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013635316.10.0PREDICTED: transcription factor MYB104-like isoform X1
TrEMBLA0A078C3B50.0A0A078C3B5_BRANA; BnaC04g17160D protein
TrEMBLA0A142BX600.0A0A142BX60_BRANA; MYB transcription factor 81-1
STRINGBra012038.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91982138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26960.11e-131myb domain protein 81